Service hotline:+86-(0)-15221025520

Product details
Cat#:130P08
Three Letter Code: H-Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg-OH trifluoroacetate salt(Disulfide bonds between Cys²¹ and Cys⁴⁷/Cys²² and Cys⁵⁴/Cys³⁴ and Cys⁵⁵)
One Letter Code: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Molecular Formula: C₃₅₀H₅₇₈N₁₀₈O₁₀₇S₈
Relative Molecular Mass: 8267.63
CAS#: 1816940-05-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Inflammation Research
Details: Complement 5a plays a central role in host defenses and
is implicated in functions associated with sepsis, adult
respiratory distress syndrome, rheumatoid arthritis,
psoriasis, neurodegeneration, and ischaemia/reperfusion
injury. The molecule has potent chemoattractant and
pro-inflammatory properties.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Shanghai Taopu-Professional peptide manufacturer.