Service hotline:+86-(0)-15221025520

Product details
Cat#:211P31
Three Letter Code: H-Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-NH₂ trifluoroacetate salt(Disulfide bonds between Cys¹ and Cys¹⁸/Cys⁴ and Cys²⁵/Cys¹⁵ and Cys³⁰/Cys¹⁹ and Cys³²)
One Letter Code: CGPCFTTDHQMEQKCAECCGGIGKCYGPQCLCNR-NH₂
Molecular Formula: C₁₄₇H₂₂₄N₄₆O₄₇S₉
Relative Molecular Mass: 3676.27
CAS#: 1926163-15-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Ion Channel Modulating Agents
Details: GaTx1 is a component of the venom of the yellow scorpion (Leiurus quinquestriatus hebraeus). The highly bridged 34-peptide, a chloride channel ligand, potently and reversibly inhibits cystic fibrosis transmembrane conductance regulator (CFTR) chloride channels when the channels are in the interburst closed state. Since the toxin inhibits CFTR only when applied to the cytoplasmic side, it is unlikely that CFTR represents the native target. Manufactured and sold under license from Georgia Tech Research Corporation, USA; patent WO/2007/137163 (PCT/US2007/069243).

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Shanghai Taopu-Professional peptide manufacturer.