Welcome to Shanghai Taopu-Professional peptide manufacturer.

Service hotline:+86-(0)-15221025520

199P56

TIP-39 trifluoroacetate salt

H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:199P56
Three Letter Code: H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH trifluoroacetate salt
One Letter Code: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Molecular Formula: C₂₀₂H₃₂₅N₆₁O₅₄S
Relative Molecular Mass: 4504.25
CAS#: 277302-47-3
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: Tuberoinfundibular peptide, TIP-39, originally isolated from bovine hypothalamus was found to be a potent and selective agonist of the pTH2 receptor which regulates pituitary hormone secretion and spinal cord regions involved in pain perception. Synthetic TIP-39 activated the human and rat pTH2 receptors with EC₅₀ of 0.5 ± 0.12 nM and 0.8 ± 0.3 nM, respectively. TIP-39 was much more potent than pTH (EC₅₀ = 49 ± 23 nM) at the rat pTH2 receptor. The discovery of TIP-39 provides an important tool for the investigation of the pTH2 receptor functions inside and outside the nervous system.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Shanghai Taopu-Professional peptide manufacturer.