Welcome to Shanghai Taopu-Professional peptide manufacturer.

Service hotline:+86-(0)-15221025520

192P05

PACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:192P05
Three Letter Code: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ trifluoroacetate salt
One Letter Code: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)
Molecular Formula: C₁₄₂H₂₂₄N₄₀O₃₉S
Relative Molecular Mass: 3147.65
CAS#: 127317-03-7
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Pituitary & Hypothalamic Hormones
Details: PACAP-38 and its N-terminal fragment PACAP-27 are neuropeptides originally isolated from ovine hypothalamus, but also found in humans and rats. Both PACAP-27, which shows considerable homology with vasoactive intestinal polypeptide (VIP), and PACAP-38 stimulate adenylate cyclase much more potently than VIP. Specific PACAP receptors have been identified in different tissues and cell lines.Kojro et al. observed that the PAC1 agonists PACAP-27 and PACAP-38 strongly increased the activity of α-secretase, thus promoting the non-amyloidogenic processing of amyloid precursor protein.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Shanghai Taopu-Professional peptide manufacturer.