Welcome to Shanghai Taopu-Professional peptide manufacturer.

Service hotline:+86-(0)-15221025520

182P50

Secretoneurin (mouse, rat) trifluoroacetate salt

H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln-OH trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:182P50
Three Letter Code: H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln-OH trifluoroacetate salt
One Letter Code: TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Synonyms: Secretogranin II (154-186) (mouse, rat)
Molecular Formula: C₁₅₉H₂₅₂N₄₀O₅₈
Relative Molecular Mass: 3651.98
CAS#: 149146-12-3
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Alzheimer´s Disease
Details: Secretogranin II (154-186) (Secretoneurin) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). It enhances dopamine release in a concentration-dependent manner. A role in neuro-immunological processes has been proposed due to its capability to act as chemoattractant for eosinophils and monocytes. Significant changes of secretoneurin-like immunoreactivity occur in Alzheimer´s disease, reflecting synaptic loss.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Shanghai Taopu-Professional peptide manufacturer.