Welcome to Shanghai Taopu-Professional peptide manufacturer.

Service hotline:+86-(0)-15221025520

179P19

Neuromedin S (human) trifluoroacetate salt

H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH₂ trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:179P19
Three Letter Code: H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH₂ trifluoroacetate salt
One Letter Code: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH₂
Synonyms: NMS (human)
Molecular Formula: C₁₇₃H₂₆₅N₅₃O₄₄
Relative Molecular Mass: 3791.34
CAS#: 1138204-27-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Obesity Research
Details: The 33-amino acid neuropeptide neuromedin S (NMS) was originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. hNMS-33 is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that NMS is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Shanghai Taopu-Professional peptide manufacturer.