Service hotline:+86-(0)-15221025520

Product details
Cat#:148P11
Three Letter Code: H-Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH₂
One Letter Code: APVSVGGGTVLAKMYPRGNHWAVGHLM-NH₂
Synonyms: Gastrin Releasing Peptide, porcine
Molecular Formula: C₁₂₆H₁₉₈N₃₈O₃₁S₂
Relative Molecular Mass: 2805.33
CAS#: 74815-57-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Gastrointestinal Research

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Shanghai Taopu-Professional peptide manufacturer.