Service hotline:+86-(0)-15221025520
/Galanin and Related Peptides (24)
/Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt

Product details
Cat#:146P20
Three Letter Code: H-Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH₂ trifluoroacetate salt
One Letter Code: ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH₂
Synonyms: GMAP (1-41) amide, Preprogalanin (65-105) amide
Molecular Formula: C₂₀₆H₃₂₆N₅₆O₆₄S
Relative Molecular Mass: 4643.26
CAS#: 132699-74-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Shanghai Taopu-Professional peptide manufacturer.