Service hotline:+86-(0)-15221025520

Product details
Cat#: 106P11
Three Letter Code: H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂
One Letter Code: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂
Molecular Formula: C₁₄₀H₂₂₇N₄₃O₄₃
Relative Molecular Mass: 3200.61
CAS#: 138398-61-5
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place
Areas of Interest: Diabetes
Details: The effect of IAPP (8-37) (mouse, rat), an amylin receptor antagonist, on the ANP release was attenuated in streptozotocin-treated rats.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Shanghai Taopu-Professional peptide manufacturer.