Welcome to Shanghai Taopu-Professional peptide manufacturer.

Service hotline:+86-(0)-15221025520

106P05

Amylin (mouse, rat)

H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂ (Disulfide bond)

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#: 106P05
Three Letter Code: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂(Disulfide bond)
One Letter Code: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH₂
Synonyms: IAPP (mouse, rat), Islet amyloid polypeptide (mouse, rat)
Molecular Formula: C₁₆₇H₂₇₂N₅₂O₅₃S₂
Relative Molecular Mass: 3920.45
CAS#: 124447-81-0
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place
Areas of Interest: Diabetes
Details: Rat amylin (rIAPP) lacks the fibril-forming capacity of human amylin (hIAPP). As a consequence, toxic effects have been reported for the human but not for the rat peptide amide.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Shanghai Taopu-Professional peptide manufacturer.