Welcome to Shanghai Taopu-Professional peptide manufacturer.

Service hotline:+86-(0)-15221025520

103P03

Adrenomedullin (11-50) (rat)

H-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ (Disulfide bond)

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#: 103P03
Three Letter Code: H-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ (Disulfide bond)
One Letter Code: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH₂
Molecular Formula: C₁₉₄H₃₀₄N₅₈O₅₉S₄
Relative Molecular Mass: 4521.17
CAS#: 163648-32-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place
Areas of Interest: Cardiovascular System & Diseases
Details: The effect of rat adrenomedullin and its C-terminal fragment rADM (11-50) was studied in the endothelium-intact arterial and venous vasculatures of the rat perfused mesenteric bed. Both peptides induced a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature. However, both peptides were inactive on the venous side of this vascular bed. Thus, these peptides share properties similar to those of CGRP (human).


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Shanghai Taopu-Professional peptide manufacturer.